PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5BL_CCDB985ED.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family FAR1
Protein Properties Length: 847aa    MW: 96402.8 Da    PI: 7.1128
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5BL_CCDB985ED.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR180.62.7e-2595183289
                   FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkk.tekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHe 88 
                            fY +YA +vGFsvr+++s+ksk +++i++ +fvCskeg+++e++    +k+r++ a+ r gC+a+l+v ++ d+kw+ tkl++eHnHe
  Traes_5BL_CCDB985ED.2  95 FYIAYAGRVGFSVRIARSRKSKCSESIIMLRFVCSKEGFSKEKRVVaGKKTRKRLASIREGCNAMLEVLRRGDNKWVATKLVKEHNHE 182
                            9**************************************999887646777888899******************************9 PP

                   FAR1  89 l 89 
                            +
  Traes_5BL_CCDB985ED.2 183 V 183
                            6 PP

2FAR162.31.4e-19217303291
                   FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHel 89 
                            fY +YA ++GF+vr+++s+ks ++++ ++ ++vCs++ +++ ++++     ++r  +r gC a +++ ++++g w+v+kl leH+Hel
  Traes_5BL_CCDB985ED.2 217 FYYSYAIRAGFEVRVRQSRKS-QDESLKMLKLVCSRHRYHSGRENN--GDDTKRDPSRDGCSALFEIIRKDKGIWRVSKLILEHTHEL 301
                            9*******************9.6777***************99988..88899999*******************************9 PP

                   FAR1  90 ap 91 
                            +p
  Traes_5BL_CCDB985ED.2 302 NP 303
                            75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031013.3E-2395183IPR004330FAR1 DNA binding domain
PfamPF031016.2E-17217303IPR004330FAR1 DNA binding domain
PfamPF105513.6E-19405494IPR018289MULE transposase domain
PROSITE profilePS509669.569671719IPR007527Zinc finger, SWIM-type
PfamPF044347.1E-5691716IPR007527Zinc finger, SWIM-type
SMARTSM005751.3E-5694721IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 847 aa     Download sequence    Send to blast
MEVGGQAMME PQGVELEDDS INFWASLGVS THVHGVDQMA LHNVHILDHQ GQSLPPAVVS  60
HPESVCKELF PVEVDPCLEP RVGMEFESGE AAKTFYIAYA GRVGFSVRIA RSRKSKCSES  120
IIMLRFVCSK EGFSKEKRVV AGKKTRKRLA SIREGCNAML EVLRRGDNKW VATKLVKEHN  180
HEVGMPSTVH YIATESDTMV DPYIDMEFES LESAKTFYYS YAIRAGFEVR VRQSRKSQDE  240
SLKMLKLVCS RHRYHSGREN NGDDTKRDPS RDGCSALFEI IRKDKGIWRV SKLILEHTHE  300
LNPAPASSVC CVRSQGEILV IAKNFADTRN LLLNGQDSQP RREIRYNDLG PEDAQSLLEY  360
LKKVQAEDPA FFYAVQLDKN EDTVNIFWAD ASARMAYYHF GDAVKFETAY RSNKEHIPIV  420
IFSGVNHHVQ PVIFGCALLV EESEESFVWL FEKWLEAMHA RPPVSFVTEL NQEMAAAAAK  480
VLPDTCHIFC EKHILGTVKE ELHSIYPGLD HFITDLRKCI DGCRIEESFE SCWESVLMKH  540
GFRNNEHLQS LYDIRKRWAP AYTKQSFHAR NLLAQSCENL EKIIDTYFSS KTQLQVAVQQ  600
LEQAICNFHA KEAQADYLTM FQLPALRTAS PVEKQAGLVF SRKVFDIFQE QFAESFGYHA  660
ERLEDRMLHK YRLTVDDGDE EAHIVSFSPD QTTVCCSCCL FESCGILCRH ALRVFIIEGV  720
RFLPKAYVLK RWTKHAKSTV TLDNYIELRG YCEDPSTSRY NDLCYDAIKC AKEGSTSTER  780
YKIAKEALCK ALDEIMPTRN IREQNSQNCT TSLKSPVKKF GTAKGTSGKS IKRPAFKNSL  840
VESNGNR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2527740.0AK252774.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf172k23, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014756691.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X3
TrEMBLW5FI470.0W5FI47_WHEAT; Uncharacterized protein
STRINGMLOC_56869.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-121FAR1-related sequence 5
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]